DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and CG33673

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001027218.2 Gene:CG33673 / 3772423 FlyBaseID:FBgn0053673 Length:235 Species:Drosophila melanogaster


Alignment Length:213 Identity:69/213 - (32%)
Similarity:118/213 - (55%) Gaps:5/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 RRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAI-LIVVFSLVALGCNEDLR 114
            ||.||.:|.:|:...|:.:.:::.........|..:.:..:|.:|.: :|::||.: :.|...|.
  Fly    22 RRIFISRVLMIVAINLLVTTLIMTFCVFHMGARKFLLKHWYIGLVGMGIILIFSFM-ICCCSFLF 85

  Fly   115 RQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLFALQTRYDFTVMGGLL 179
            |.:|..:|.|..:.:|.|.::..||.||.|..:|:||...|::.:.|.|||.....|||.....:
  Fly    86 RSSPCKYILLVIYVLAHSTVVCSAAVRYQPKLVFIAVASCAAIVVMLCLFARFAPCDFTGCWIFV 150

  Fly   180 VSCLIILLFFGIVTIFVGGHMVTTIYASLSALLFSVYLVYDTQLMM-GGKHRYSISPEEYIFAAL 243
            ....:::|..|||.||.  ..:..:||||..|||.||:|.|.|::: ||.|:......:|:.||:
  Fly   151 FVLSLVVLIMGIVAIFF--PTIRIVYASLGVLLFCVYIVIDVQMIIGGGTHKNEFDESDYVLAAM 213

  Fly   244 NIYMDVMNIFLDILQLIG 261
            ::|.|::.:||.:|.|||
  Fly   214 SLYSDIVFLFLYLLDLIG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 67/211 (32%)
CG33673NP_001027218.2 LFG_like 16..231 CDD:198410 67/211 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439710
Domainoid 1 1.000 62 1.000 Domainoid score I575
eggNOG 1 0.900 - - E1_COG0670
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I411
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.