DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and Tmbim1

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001007714.1 Gene:Tmbim1 / 316516 RGDID:1359409 Length:309 Species:Rattus norvegicus


Alignment Length:268 Identity:90/268 - (33%)
Similarity:140/268 - (52%) Gaps:28/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PVH----QYGNRSHQAECIPLGRYTAYGSEIGQDDPDKGLGFCSASIRRGFIRKVYLILLAQLIT 68
            |||    .||:...:.|       .|.....|..:.|      ...:|..||:|||.|:..||:.
  Rat    59 PVHPMPMNYGHDYSEEE-------RAGSDSFGPGEWD------DRKVRHTFIQKVYCIISVQLLI 110

  Fly    69 SLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNEDLRRQTPANFIFLSAFTIAESF 133
            ::.:|...|..:.|...|..:..::.|:..:.:.:.:.|.|.:..||:.|.|.|.|:.||:|..|
  Rat   111 TVAIIAVFTFVEPVSEYVRSNVAVYYVSYAVFIVTYLILVCCQGPRRRFPWNIILLTIFTLALGF 175

  Fly   134 LLGVAACRYAPMEIFMAVLITASVCLGLTLFALQTRYDFTVMGGLLVSCLIILLFFGIVTIFV-- 196
            :.|..:..|....:.:|::|||.|.:.:|:|..||:.|||...||:....|:|...|.||..|  
  Rat   176 MTGAISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLICVLGIVLAVTGAVTSVVLF 240

  Fly   197 -----GGHMVTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISPEEYIFAALNIYMDVMNIFLDI 256
                 ..|||   ||.|.|:.|:::|.|||||::|.: :::||||:||..||.||.|::.||..:
  Rat   241 FEYIYWLHMV---YAGLGAICFTLFLAYDTQLVLGNR-KHTISPEDYITGALQIYTDIVYIFTFV 301

  Fly   257 LQLIGGSD 264
            |||:|..|
  Rat   302 LQLVGNRD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 79/223 (35%)
Tmbim1NP_001007714.1 LFG_like 87..306 CDD:198410 80/228 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.