DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and si:ch211-284o19.8

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_001341582.3 Gene:si:ch211-284o19.8 / 100007937 ZFINID:ZDB-GENE-070912-289 Length:300 Species:Danio rerio


Alignment Length:228 Identity:78/228 - (34%)
Similarity:135/228 - (59%) Gaps:5/228 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PDKGLGFCSA----SIRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILI 99
            |::...|.||    .:::.|||||:.::..||:.:..|:...|..|.|:..|.::.||::.:.::
Zfish    70 PEEHQVFVSAFDDNKVQKAFIRKVFSVVTIQLLVTFTVVCVFTFSKTVKEAVQKNIWIYISSYIV 134

  Fly   100 VVFSLVALGCNEDLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLF 164
            .:...:.|..:....|:.|.|.:.||..|::.|:::|..|..:....:.:|:..|..:...:.:|
Zfish   135 FMVVALCLSVSSTFSRKHPWNLVGLSMVTLSLSYMVGTVASYHNTTAVIIALGSTLVISFTIIIF 199

  Fly   165 ALQTRYDFTVMGGLLVSCLIILLFFGIVTIFVGGHMVTTIYASLSALLFSVYLVYDTQLMMGGKH 229
            :.|||.|||:..|:|:...|.||.||..:||....::..:|..|.|||::::|..|.||:| |:.
Zfish   200 SAQTRLDFTICNGVLLILSIDLLMFGFFSIFFYSSVLQIVYGCLGALLYALFLAVDCQLVM-GRQ 263

  Fly   230 RYSISPEEYIFAALNIYMDVMNIFLDILQLIGG 262
            :||:.|||||||||.||:|::.|||.||.::||
Zfish   264 KYSLDPEEYIFAALIIYLDIIMIFLYILMILGG 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 75/220 (34%)
si:ch211-284o19.8XP_001341582.3 LFG_like 79..295 CDD:198410 73/216 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.