DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and faim2b

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001373641.1 Gene:faim2b / 100006044 ZFINID:ZDB-GENE-120426-3 Length:263 Species:Danio rerio


Alignment Length:230 Identity:88/230 - (38%)
Similarity:145/230 - (63%) Gaps:6/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DKGLGFCSASIRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSL 104
            |.|..:..||:||.||||||.||:.||.:::.||...|....||:.:.....::..:.|:.:.:.
Zfish    35 DGGFTWDDASVRRIFIRKVYSILMLQLFSTVAVIALFTFHAPVRMYIQTHPILYSASNLLFLITY 99

  Fly   105 VALGCNEDLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLFALQTR 169
            ::|.|..|||||.|.|.|.|:.||::.:.:||..:..|....:.:.:.|||.|||.:|||:.|::
Zfish   100 ISLACCGDLRRQFPWNLILLTVFTLSMACMLGFISSFYNTKAVVLCIGITAVVCLCVTLFSFQSK 164

  Fly   170 YDFTVMGGLLVSCLIILLFFGIVTIFV--GGHM--VTTIYASLSALLFSVYLVYDTQLMMGGKHR 230
            .|.|...|||....:::.|..||..||  .|::  :..:|:|:.|::|:::|.:||||:||.| :
Zfish   165 IDITSYQGLLFILCMVMFFCAIVMGFVVPFGYVPWLHAVYSSIGAVVFTMFLAFDTQLLMGNK-Q 228

  Fly   231 YSISPEEYIFAALNIYMDVMNIFLDILQLIG-GSD 264
            |::|||||:||.|::|:|::.:|..:||:.| |.|
Zfish   229 YTLSPEEYVFATLSLYLDIVYLFTFLLQMFGQGRD 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 83/220 (38%)
faim2bNP_001373641.1 LFG_like 39..259 CDD:198410 83/220 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.