DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and krt95

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_001002392.1 Gene:krt95 / 436665 ZFINID:ZDB-GENE-040718-88 Length:425 Species:Danio rerio


Alignment Length:173 Identity:38/173 - (21%)
Similarity:69/173 - (39%) Gaps:43/173 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 TANFFKTPLLLTNSQINVSDFKANAGLSLQKDPKEIRKTVNDCGISFSVVYSKKVIGSGQASFPS 125
            |.|..|..:...|  :|      ||.:.||.|..::  ..:|    |.:.|..::          
Zfish   145 TINCLKEQIAAAN--VN------NANILLQIDNSKL--AADD----FRIKYEHEI---------- 185

  Fly   126 SVVDSIEKDMTDILHSDVIDLA--AGGEVTGKLEFLCRLVVMCIADEPELEC-ARNMDRSINAQD 187
            :|...:|.|:.::..  ::|.|  :..|:..::|.|       |.|   ||| .:|....:.|  
Zfish   186 AVRQCVESDIANLRR--LLDQATLSKAELENQIETL-------IGD---LECLKKNHQEDVAA-- 236

  Fly   188 IMFVMGESQVCPSACEPCQNDLEAEEGDERLRLD--LERYRSQ 228
            :|..:..|:||.......|.||.....|.|...:  ::::|.:
Zfish   237 LMCQLTNSKVCVEVDAAPQQDLNKILDDIRCHYENIIDKHRRE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440 38/173 (22%)
DUF4776 345..788 CDD:406413
krt95NP_001002392.1 Filament 91..398 CDD:459643 38/173 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.