DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and CG3199

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster


Alignment Length:208 Identity:81/208 - (38%)
Similarity:117/208 - (56%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KKSVAVAIAETKPEDQPPPEKVKPKKEPIPVFVFDVIVTHLEAKNTEFTNPSKLEVTANFFKTPL 69
            ||||..|.:...|  ..|||.|..:.  :|||.||:::|.||.|.....:..||.|...|....|
  Fly    13 KKSVFRAKSTVVP--TAPPEPVFDRN--LPVFSFDLVITRLEVKGVVLADARKLLVKVKFGGNNL 73

  Fly    70 LLTNSQINVSDFKANAGLSLQKDPKEIRKTVNDCGISFSVVYSKKVIGSGQASFPSSVVDSIEKD 134
            .||.|:.|||:||.||..:.|.:|..:.:||.:.||.|.|||.::|:|.|:.|.|..:...|:.|
  Fly    74 SLTASRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLD 138

  Fly   135 MTDILHSDVIDLAAGGEVTGKLEFLCRLVVMCIADEPELECARNMDRSINAQDIMFVMGESQVCP 199
            |....::....|...|:..|.|||||:|.:.|.....|.|...|:||:::.:||:||:|:||...
  Fly   139 MKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANT 203

  Fly   200 SACEPCQNDLEAE 212
            |.|:||::.||.|
  Fly   204 SCCDPCRDALEIE 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440 66/172 (38%)
DUF4776 345..788 CDD:406413
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 65/170 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.