DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and KRT34

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:XP_011523095.1 Gene:KRT34 / 3885 HGNCID:6452 Length:412 Species:Homo sapiens


Alignment Length:193 Identity:38/193 - (19%)
Similarity:72/193 - (37%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EKVKPKKEPIPVFVFDVIVTHLEAKNTEFTNPSKLEVTANFFKTPLLLTNSQINVSDFKANAGLS 88
            :::..:.:..|....:.::....::.......::.|| ..:|.|.....|.|:..|..:..   |
Human   225 DRLNVEVDTAPTVDLNQVLNETRSQYEALVEINRREV-EQWFATQTEELNKQVVSSSEQLQ---S 285

  Fly    89 LQKDPKEIRKTVNDCGISFSVVYS-----KKVIGSGQASFPS------SVVDSIEKDMTDILHSD 142
            .|.:..|:|:|||...|.....::     :..:...:|.:.|      |::.::|..:.:|.   
Human   286 CQAEIIELRRTVNALEIELQAQHNLRDSLENTLTESEAHYSSQLSQVQSLITNVESQLAEIR--- 347

  Fly   143 VIDLAAGGEVTGKLEFLCRLVVMCIADEPELECARNMDRSINAQDIMFVMGESQVCPSACEPC 205
             .||....:     |:...|.|     ...|||..|..||:.         ||:.|...|.||
Human   348 -CDLERQNQ-----EYQVLLDV-----RARLECEINTYRSLL---------ESEDCKLPCNPC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440 37/176 (21%)
DUF4776 345..788 CDD:406413
KRT34XP_011523095.1 Filament 73..384 CDD:459643 34/185 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.