DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and KRT14

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_000517.3 Gene:KRT14 / 3861 HGNCID:6416 Length:472 Species:Homo sapiens


Alignment Length:176 Identity:52/176 - (29%)
Similarity:67/176 - (38%) Gaps:42/176 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 GVFGMMGGGPHG-PNPMPCGRPRVPGAWGVGAG------GDGGGIGGGGGARGVLGGGRSARGGG 865
            |:.|.:|||... .:.:..|..|.|..:|.|..      ..||..|.|||..|......|:.|.|
Human    19 GIGGGIGGGSSRISSVLAGGSCRAPSTYGGGLSVSSSRFSSGGACGLGGGYGGGFSSSSSSFGSG 83

  Fly   866 AGGG-GFRGPGGPGGGPGGGAWKGFPTAAVGKAQGQGKGKGEKSEPIPVRYPKRFLKPAEEAAKA 929
            .||| |    ||.|.|.|||...||       |.|.|...|  ||.:.::.....|....:..:|
Human    84 FGGGYG----GGLGAGLGGGFGGGF-------AGGDGLLVG--SEKVTMQNLNDRLASYLDKVRA 135

  Fly   930 AKEAEKAAVDAKKKGINMIKYLQKKGTLVRPW----NPQEGKDKRP 971
            .:|| .|.::.|                :|.|    .|.|.||..|
Human   136 LEEA-NADLEVK----------------IRDWYQRQRPAEIKDYSP 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440
DUF4776 345..788 CDD:406413
KRT14NP_000517.3 Head 1..114 37/107 (35%)
Filament 114..425 CDD:459643 15/68 (22%)
Coil 1A 115..150 8/51 (16%)
Linker 1 151..168 5/14 (36%)
Coil 1B 169..260
Linker 12 261..283
Coil 2 284..422
Tail 423..472
Interaction with Type I keratins and keratin filaments 425..472
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 426..472
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.