DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and KRT13

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_705694.3 Gene:KRT13 / 3860 HGNCID:6415 Length:458 Species:Homo sapiens


Alignment Length:174 Identity:59/174 - (33%)
Similarity:77/174 - (44%) Gaps:34/174 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   808 GVFG----MMGGGPHGPNPMPCGRPRVPGAWGVGAGGDGGGI--GGGGGARGVLGGGRSARGGGA 866
            |.||    .:||| .|.:  .|....|.|.   .|||.|||:  |.||||....|||   .|||.
Human    14 GGFGGGSCQLGGG-RGVS--TCSTRFVSGG---SAGGYGGGVSCGFGGGAGSGFGGG---YGGGL 69

  Fly   867 GGG-GFRGPGGPGGGPGGGAWKGFPTAAVGKAQGQGKGKGEKSEPIPVRYPKRFLKPAEEAAKAA 930
            ||| |    ||.|||.|||...||  ...|...|   |....:|.|.::.....|....|..:|.
Human    70 GGGYG----GGLGGGFGGGFAGGF--VDFGACDG---GLLTGNEKITMQNLNDRLASYLEKVRAL 125

  Fly   931 KEAEKAAVDAKKKGINMIKYLQKKGTLVRPWNP-----QEGKDK 969
            :|| .|.::.|.:..::   .|...:..|.::|     :|.:||
Human   126 EEA-NADLEVKIRDWHL---KQSPASPERDYSPYYKTIEELRDK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440
DUF4776 345..788 CDD:406413
KRT13NP_705694.3 Head 1..103 44/106 (42%)
Filament 103..415 CDD:459643 15/67 (22%)
Coil 1A 104..139 9/35 (26%)
Linker 1 140..158 3/20 (15%)
Coil 1B 159..250 3/7 (43%)
Linker 12 251..273
Coil 2 274..412
Tail 413..458
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..458
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.