DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and KRT12

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_000214.1 Gene:KRT12 / 3859 HGNCID:6414 Length:494 Species:Homo sapiens


Alignment Length:191 Identity:49/191 - (25%)
Similarity:64/191 - (33%) Gaps:62/191 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   782 RGFDC-AVGDRYMGTAFGWPGEMVFEDGVFGMMGGGPHGPNPMPCGRPRVPGAWGVGAGGDGGGI 845
            ||... :||..|.|:|||           ||...||               |.......|...|.
Human    31 RGMSASSVGSGYGGSAFG-----------FGASCGG---------------GFSAASMFGSSSGF 69

  Fly   846 GGGGGARGVLGGGRSARGGGAGGGGFRGPG-GPGGGPGGGAWKGFPTAAVGKAQGQGKGKGEKSE 909
            |||.|: .:.||..:..|...|||.|.|.| |.||.||||        ::|...|...|....||
Human    70 GGGSGS-SMAGGLGAGYGRALGGGSFGGLGMGFGGSPGGG--------SLGILSGNDGGLLSGSE 125

  Fly   910 PIPVRYPKRFLKPAEEAAKAAKEAEKAAVDAKKKGINMIKYLQKKGT----LVRPWNPQEG 966
                                 ||..:...|.....::.::.|::..|    .:|.|....|
Human   126 ---------------------KETMQNLNDRLASYLDKVRALEEANTELENKIREWYETRG 165

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440
DUF4776 345..788 CDD:406413 2/6 (33%)
KRT12NP_000214.1 Head 1..124 39/127 (31%)