DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and KRT9

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_000217.2 Gene:KRT9 / 3857 HGNCID:6447 Length:623 Species:Homo sapiens


Alignment Length:109 Identity:45/109 - (41%)
Similarity:51/109 - (46%) Gaps:4/109 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   801 GEMVFEDGVFGMMGGGPHGPNPMPCGRPRVPGAWG-VGAGGDGGGIGGGGGARGVLG---GGRSA 861
            |:..||....|.:|.|..|.:....||....|:.| .|.||.|||.|||.|:||..|   ||.|.
Human   461 GQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSG 525

  Fly   862 RGGGAGGGGFRGPGGPGGGPGGGAWKGFPTAAVGKAQGQGKGKG 905
            .|||:|||...|.||...|..||...|......|...|.|.|.|
Human   526 SGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSG 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440
DUF4776 345..788 CDD:406413
KRT9NP_000217.2 Head 1..152
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Filament 152..464 CDD:459643 1/2 (50%)
Coil 1A 153..188
Linker 1 189..207
Coil 1B 208..299
Linker 12 300..322
Coil 2 323..461 45/109 (41%)
Tail 462..623 44/108 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..496 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 534..623 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.