DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and Krt35

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_001008820.1 Gene:Krt35 / 287697 RGDID:1305300 Length:455 Species:Rattus norvegicus


Alignment Length:147 Identity:32/147 - (21%)
Similarity:50/147 - (34%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NSQINVSDFKANAGLSLQKDPKEIRKTVNDCGISFSVVYSKK-----VIGSGQASFPSS------ 126
            |.|:..|..:..   |.|.|..|:|:|||...|......|.:     .:...:|.:.|.      
  Rat   296 NQQVVTSSEQLQ---SCQSDIIELRRTVNSLEIELQAQQSMRDALDSTLAETEARYSSQLAQMQC 357

  Fly   127 VVDSIEKDMTDILHSDVIDLAAGGEVTGKLEFLCRLVVMCIADEPELECARNMDRSINAQDIMFV 191
            ::.|:|..:              ||:...||...:...:.:.....|||..|..|.:.       
  Rat   358 LIGSVESQL--------------GEIRADLERQNQEYQVLLDVRARLECEINTYRGLL------- 401

  Fly   192 MGESQVCPSACEPCQND 208
              ||:.....|.||..|
  Rat   402 --ESEDSKLPCNPCAPD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440 32/147 (22%)
DUF4776 345..788 CDD:406413
Krt35NP_001008820.1 Filament 96..407 CDD:459643 28/136 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.