DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and Krt24

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_001004131.1 Gene:Krt24 / 287675 RGDID:1303157 Length:491 Species:Rattus norvegicus


Alignment Length:195 Identity:47/195 - (24%)
Similarity:71/195 - (36%) Gaps:64/195 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   787 AVGDR---YMGTAFGWPGEMVFEDGVFGMMGGGPHGPNPMPCGRPRVPGAWGVGAGGDGGGIGGG 848
            |||.|   ..|:::|              :|||               .|||........|:  .
  Rat    19 AVGSRGCTGSGSSYG--------------LGGG---------------SAWGFQGSSSSWGL--S 52

  Fly   849 GGARGVLGGGRSA---RGGGAGGGGFRGPGGPGGGPGGGAWKGFPTAAVGKAQGQGKG--KGEKS 908
            ||::|.:|||.|:   |||...|..|.|..|.|||..||      .::.|.:.|.|.|  .|   
  Rat    53 GGSKGSIGGGFSSCSVRGGFGAGSSFGGGSGFGGGSSGG------VSSYGGSLGGGLGGIGG--- 108

  Fly   909 EPIPVRYPKRFLKPAEEAAKAAKEAEKAAVDAKKKGINMIKYLQKKG----TLVRPWNPQEGKDK 969
                  |....|..:|      |:..:...|.....::.::.|::..    |.::.|..:.|..|
  Rat   109 ------YDGGLLSGSE------KQTMQGLNDRLANYLDKVRALEEANTDLETKIKDWYGRHGSGK 161

  Fly   970  969
              Rat   162  161

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440