DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14355 and Krt12

DIOPT Version :10

Sequence 1:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster
Sequence 2:NP_034791.2 Gene:Krt12 / 268482 MGIID:96687 Length:487 Species:Mus musculus


Alignment Length:81 Identity:32/81 - (39%)
Similarity:33/81 - (40%) Gaps:9/81 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 GRPRVPGAWGVGAGGDGGGIGGGGGARGV-LGGGRSARGGGAGGGGFRGPGGPGGGPGGGAWKGF 889
            |||     ||..|....||.||.....|| .||..||........||.| |..|..||.|:..|.
Mouse    22 GRP-----WGASASSVAGGYGGSASGFGVGCGGLFSAASMFGSSSGFSG-GSAGCLPGLGSAYGG 80

  Fly   890 PTAAVGKAQGQGKGKG 905
            |..  |.|.|.|.|.|
Mouse    81 PLR--GGAGGMGIGMG 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14355NP_650340.1 DUF4788 41..265 CDD:406440
DUF4776 345..788 CDD:406413
Krt12NP_034791.2 Head 1..118 32/81 (40%)
Filament 118..428 CDD:459643
Coil 1A 119..154
Linker 1 158..175
Coil 1B 176..267
Linker 12 268..290
Coil 2 291..428
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..461
Tail 429..487
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.