DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpII140 and LOC100537264

DIOPT Version :9

Sequence 1:NP_001287323.1 Gene:RpII140 / 41721 FlyBaseID:FBgn0262955 Length:1176 Species:Drosophila melanogaster
Sequence 2:XP_003201781.2 Gene:LOC100537264 / 100537264 -ID:- Length:258 Species:Danio rerio


Alignment Length:252 Identity:201/252 - (79%)
Similarity:226/252 - (89%) Gaps:0/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MYDNEEELYEEENAEEISHELWQEACWIVINAYFDEKGLVRQQLDSFDEFIQMSVQRIVEDSPAI 66
            |||.:|::..:|:.:||:.:||||||||||::|||||||||||||||||||||||||||||:|.|
Zfish     1 MYDQDEDIQYDEDDDEITPDLWQEACWIVISSYFDEKGLVRQQLDSFDEFIQMSVQRIVEDAPPI 65

  Fly    67 ELQAEAQHTSGEVETPPRFSLKFEQIYLSKPTHWEKDGSPSPMMPNEARLRNLTYSAPLYVDITK 131
            :|||||||||||||.|||:.|||||||||||||||:||:||||||||||||||||||||||||||
Zfish    66 DLQAEAQHTSGEVEEPPRYLLKFEQIYLSKPTHWERDGAPSPMMPNEARLRNLTYSAPLYVDITK 130

  Fly   132 TKNVEGLDPVETQHQKTFIGKIPIMLRSTYCLLSQLTDRDLTELNECPLDPGGYFIINGSEKVLI 196
            |...:|.:..:|||||||||||||||||||||||.||||||.|||||||||||||||||||||||
Zfish   131 TIIKDGEEQQQTQHQKTFIGKIPIMLRSTYCLLSGLTDRDLCELNECPLDPGGYFIINGSEKVLI 195

  Fly   197 AQEKMATNTVYVFSMKDGKYAFKTEIRSCLEHSSRPTSTLWVNMMARGSQNIKKSAI 253
            |||||||||||||:.||.|||:..|.|||||:|||||||:||:|||||.|.:..|.:
Zfish   196 AQEKMATNTVYVFAKKDSKYAYTGECRSCLENSSRPTSTIWVSMMARGGQVVLVSIL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpII140NP_001287323.1 PRK08565 28..1176 CDD:236291 188/226 (83%)
LOC100537264XP_003201781.2 RNA_pol_B_RPB2 39..>245 CDD:305168 176/205 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580578
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000346
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.