DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 140up and Timmdc1

DIOPT Version :9

Sequence 1:NP_001262561.1 Gene:140up / 41720 FlyBaseID:FBgn0010340 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_077235.2 Gene:Timmdc1 / 76916 MGIID:1922139 Length:285 Species:Mus musculus


Alignment Length:222 Identity:69/222 - (31%)
Similarity:122/222 - (54%) Gaps:7/222 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLERLKQMFTIDEFGSISSELNSVYQA 73
            |...||.:     |||.....|::..::.::.....|:|.:||:|:|..||....|.|::.:|:|
Mouse    21 RVFAAGAV-----AADSPGFVEDREQRSGVSDPGSLESGWDRLRQLFAKDEQQRFSKEIDYIYRA 80

  Fly    74 GFLGFLIGAIYGGVTQSRVAYMNFMENNQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLF 138
            .....:||..|||:.....|...::|.:||..:.:.|||.:......|..|.:.|::|.||..:|
Mouse    81 AVSAGIIGWAYGGIPAFIYAKKRYIEQSQAEIYHNRFDAVQSAHRAATRGFIRYGWRWSWRTAVF 145

  Fly   139 TTSYFGIITCMSVYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSLLLM 203
            .|.:..:.|.::|||.|.::..:..||::||.|::::||:||:.||.|||..||...|...:.|.
Mouse   146 VTIFNTVNTGLTVYRNKDAMSHFAIAGAVTGGLFRINLGVRGLVAGSIIGALLGAPMGSLLMALE 210

  Fly   204 KASGTSMEEVRYWQYKWRLDRDENIQQ 230
            |.||.:::|.|  |.:|:...::.:::
Mouse   211 KYSGETVQERR--QKEWKALHEQRLEE 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
140upNP_001262561.1 Tim17 67..179 CDD:280604 34/111 (31%)
Timmdc1NP_077235.2 Tim17 74..203 CDD:280604 43/128 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846899
Domainoid 1 1.000 89 1.000 Domainoid score I7890
eggNOG 1 0.900 - - E1_KOG4608
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9578
Inparanoid 1 1.050 128 1.000 Inparanoid score I4655
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007047
OrthoInspector 1 1.000 - - oto92668
orthoMCL 1 0.900 - - OOG6_107776
Panther 1 1.100 - - LDO PTHR13002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3417
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.