DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 140up and timmdc1

DIOPT Version :9

Sequence 1:NP_001262561.1 Gene:140up / 41720 FlyBaseID:FBgn0010340 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001017828.1 Gene:timmdc1 / 550526 ZFINID:ZDB-GENE-050417-369 Length:292 Species:Danio rerio


Alignment Length:262 Identity:73/262 - (27%)
Similarity:131/262 - (50%) Gaps:39/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RFLIAGILPTF--EGAADEIVDKENKTYKAFLASKPP-EETGLERLKQMFTIDEFGSISSELNSV 70
            |.|:...||:.  ..::.:|:.|.        ..||. .:||.:|:|.:|...| |..:.||.:|
Zfish    30 RALLGFTLPSVYASDSSTQILPKH--------IGKPEFPDTGWDRIKDLFYNVE-GQYTEELRNV 85

  Fly    71 YQAGFLGFLIGAIYGGVTQSRVAYMNFMENNQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRV 135
            .::|....::|.||||:..:|.|...|::.:||..:::..||.:...:.....|.:.|::|.|||
Zfish    86 VKSGIASAIVGMIYGGLPGARHARQRFIQCSQAEIYRNRVDAVRAAHNAAIRGFLRFGWRWSWRV 150

  Fly   136 GLFTTSYFGIITCMSVYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL 200
            ..|.|.:..:.|.::|||.::::..:..:|::||.:::::|||||:.:|.|||..||..|||..|
Zfish   151 AAFVTLFNTVNTGLTVYRDQNALSHFAVSGAVTGGVFRLNLGLRGLLSGTIIGVILGFPAGVLIL 215

  Fly   201 LLMKASGTSM-----------EEVRYWQYKWRL----------------DRDENIQQAFKKLTED 238
            .|....|.:|           .|:|..::..||                |.:.::||..:.|::.
Zfish   216 GLQNLGGETMRDKRRRERRELHELRVTEWNARLKVTDDLIGEMSSLKHQDSEIDLQQVEELLSQP 280

  Fly   239 EN 240
            .|
Zfish   281 RN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
140upNP_001262561.1 Tim17 67..179 CDD:280604 32/111 (29%)
timmdc1NP_001017828.1 Tim17 85..214 CDD:280604 43/128 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592103
Domainoid 1 1.000 87 1.000 Domainoid score I7999
eggNOG 1 0.900 - - E1_KOG4608
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9578
Inparanoid 1 1.050 113 1.000 Inparanoid score I4836
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1366254at2759
OrthoFinder 1 1.000 - - FOG0007047
OrthoInspector 1 1.000 - - oto41280
orthoMCL 1 0.900 - - OOG6_107776
Panther 1 1.100 - - LDO PTHR13002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3417
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.