DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 140up and Y38F2AR.3

DIOPT Version :9

Sequence 1:NP_001262561.1 Gene:140up / 41720 FlyBaseID:FBgn0010340 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001255239.1 Gene:Y38F2AR.3 / 177026 WormBaseID:WBGene00021421 Length:288 Species:Caenorhabditis elegans


Alignment Length:228 Identity:64/228 - (28%)
Similarity:99/228 - (43%) Gaps:39/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 TGLERLKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVT---QSRVAYMNFMENNQATAFK 107
            ||.||||.::..:.    |.|.:..::...:.||.|.:.||.|   |:|.||..   ||....:.
 Worm    64 TGWERLKSIYEREN----SMEKDVTFRVVRMSFLGGFLVGGATGYAQARHAYET---NNVGRKYL 121

  Fly   108 SHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMSVYRGKSSIYEYLAAGSIT---- 168
            |..||.|:..|...|.||||||..|::..|.:.|...:.|.::.||.|.:.:.:.|....|    
 Worm   122 SPSDAVKRKIDYAIVRFAKGGFGVGFKCALISGSIVFLATHITAYRDKFASWYFPAISGATACLL 186

  Fly   169 ---GSLYKVSLGLRG-MAAGGIIGGFLGGVAGVTSLLLMKASGTSMEEVRYWQYKWRLDRDENIQ 229
               |.::...:||.| |.|.|:         ||||.|.:.|.          .:.:.:..|:.:.
 Worm   187 HTVGGVFTFPIGLLGSMKAVGL---------GVTSGLTLSAV----------VHLYAMAIDKPVN 232

  Fly   230 QAFKKLTEDENPELFKAH--DEKTSEHVSLDTI 260
            .|::....|...||..|.  |.:.||.:..:.|
 Worm   233 DAYRLFKRDYEKELKSASEWDSRVSELMEREQI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
140upNP_001262561.1 Tim17 67..179 CDD:280604 35/121 (29%)
Y38F2AR.3NP_001255239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164536
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I4008
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007047
OrthoInspector 1 1.000 - - oto18555
orthoMCL 1 0.900 - - OOG6_107776
Panther 1 1.100 - - LDO PTHR13002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3417
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.920

Return to query results.
Submit another query.