DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment 140up and timmdc1

DIOPT Version :9

Sequence 1:NP_001262561.1 Gene:140up / 41720 FlyBaseID:FBgn0010340 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001120563.1 Gene:timmdc1 / 100145717 XenbaseID:XB-GENE-6455424 Length:258 Species:Xenopus tropicalis


Alignment Length:221 Identity:71/221 - (32%)
Similarity:121/221 - (54%) Gaps:14/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PE--ETGLERLKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMENNQATA 105
            ||  |:|.:|::::|..:|.|....|:.||.::|..|.|:|.:||||..:|.:...:::.:||..
 Frog    23 PETPESGWDRIQELFQPNEQGQYPEEVGSVLKSGLTGALLGWVYGGVPAARHSKERYIQQSQAEI 87

  Fly   106 FKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMSVYRGKSSIYEYLAAGSITGS 170
            ::...:|.:...:.....|.:.|::|||||..|.|.:..:.|.:||||.:.::..|.|||::||.
 Frog    88 YQHRVEAVRSAHNAALRGFIRYGWRWGWRVAAFVTIFNSVSTGLSVYRDRVALGHYAAAGAVTGG 152

  Fly   171 LYKVSLGLRGMAAGGIIGGFLGGVAGVTSLLLMKASGTSMEEVRYWQYKWRLDRDE----NIQQ- 230
            |::::|||.|:.:|.:||..||..||.....|...||.|:.:      |.|.:|.|    .:|: 
 Frog   153 LFRLNLGLGGLLSGSLIGAALGVPAGAMISGLQSLSGESIRD------KKRRERQELYENKLQEW 211

  Fly   231 -AFKKLTEDENPELFKAHDEKTSEHV 255
             |..::||....|:..|..|...:.|
 Frog   212 SARLQVTEGVLQEMEAAQLEPVEQQV 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
140upNP_001262561.1 Tim17 67..179 CDD:280604 37/111 (33%)
timmdc1NP_001120563.1 Tim17 49..>150 CDD:280604 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7535
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4645
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007047
OrthoInspector 1 1.000 - - oto102955
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.