DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twf and ADF6

DIOPT Version :9

Sequence 1:NP_650338.1 Gene:twf / 41719 FlyBaseID:FBgn0038206 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_565719.1 Gene:ADF6 / 817676 AraportID:AT2G31200 Length:146 Species:Arabidopsis thaliana


Alignment Length:128 Identity:33/128 - (25%)
Similarity:54/128 - (42%) Gaps:26/128 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KAKNGKFRVIKVSIENEQLSCGATAETKKDWERDYDKLIGPLLEKDVPC-YILYRLD-------- 74
            :.|..::.|.|:....:::....|....:    .||..:..|.:.|  | |.:|..|        
plant    30 RKKTHRYVVFKIDESKKEVVVEKTGNPTE----SYDDFLASLPDND--CRYAVYDFDFVTSENCQ 88

  Fly    75 -AKIPLGYSWLLISWTPDTASIRQKMVYASTKATLKTEF-GSAYITEELHATTLDECTLEGYR 135
             :||      ...:|:|.|:.||.|::|:::|..|..|. |..|   |:.||...|..||..|
plant    89 KSKI------FFFAWSPSTSGIRAKVLYSTSKDQLSRELQGIHY---EIQATDPTEVDLEVLR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twfNP_650338.1 ADF_Twf-N_like 4..142 CDD:200441 33/128 (26%)
ADF_Twf-C_like 176..310 CDD:200440
ADF6NP_565719.1 ADF_gelsolin 11..145 CDD:301701 33/128 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.