DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twf and TLR9

DIOPT Version :10

Sequence 1:NP_650338.1 Gene:twf / 41719 FlyBaseID:FBgn0038206 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_059138.1 Gene:TLR9 / 54106 HGNCID:15633 Length:1032 Species:Homo sapiens


Alignment Length:118 Identity:29/118 - (24%)
Similarity:39/118 - (33%) Gaps:41/118 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PLLEKDVPCYILYRLDAKI--PLGYSWLLISWTPDTASIR-----QKMVY---ASTKA------- 106
            |.|..|...: |.||:..:  ....|||..||.....::|     :..:|   ..|||       
Human   273 PQLHPDTFSH-LSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQL 336

  Fly   107 ------------------TLKTEFGSAYITEEL--HA---TTLDECTLEGYRR 136
                              :|...|||....:||  |.   .:|||.||....|
Human   337 RKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIFFRSLDETTLRPLAR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twfNP_650338.1 ADF_Twf-N_like 4..142 CDD:200441 29/118 (25%)
ADF_Twf-C_like 176..310 CDD:200440
TLR9NP_059138.1 leucine-rich repeat 43..64 CDD:275380
LRR 1 62..85
LRR_8 64..135 CDD:404697
leucine-rich repeat 65..88 CDD:275380
LRR 2 87..110
leucine-rich repeat 89..124 CDD:275380
LRR 113..504 CDD:443914 29/118 (25%)
LRR 3 122..147
leucine-rich repeat 125..144 CDD:275380
leucine-rich repeat 145..168 CDD:275380
LRR 4 150..166
LRR 5 167..190
leucine-rich repeat 169..200 CDD:275380
LRR 6 198..221
leucine-rich repeat 201..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
LRR 7 223..242
LRR 8 243..268
leucine-rich repeat 246..285 CDD:275380 4/12 (33%)
LRR 9 283..306 8/22 (36%)
leucine-rich repeat 286..307 CDD:275380 6/20 (30%)
LRR 10 308..332 5/23 (22%)
leucine-rich repeat 310..335 CDD:275380 5/24 (21%)
LRR 11 333..356 0/22 (0%)
leucine-rich repeat 336..365 CDD:275380 4/28 (14%)
LRR 12 363..386 8/22 (36%)
leucine-rich repeat 366..392 CDD:275380 9/24 (38%)
LRR 13 390..413 29/118 (25%)
leucine-rich repeat 393..416 CDD:275380
LRR 14 415..440
leucine-rich repeat 417..472 CDD:275380
LRR 15 470..494
leucine-rich repeat 476..497 CDD:275380
LRR 495..>739 CDD:443914
LRR 16 496..519
leucine-rich repeat 498..522 CDD:275380
LRR 17 520..543
leucine-rich repeat 523..546 CDD:275380
LRR 18 545..572
leucine-rich repeat 547..599 CDD:275380
LRR 19 574..598
leucine-rich repeat 600..629 CDD:275380
LRR 20 600..622
LRR 21 627..650
leucine-rich repeat 630..654 CDD:275380
LRR 22 652..675
leucine-rich repeat 655..678 CDD:275380
LRR 23 676..699
leucine-rich repeat 679..702 CDD:275380
LRR 24 701..723
leucine-rich repeat 703..726 CDD:275380
LRR 25 724..747
leucine-rich repeat 727..748 CDD:275380
LRR 26 749..772
leucine-rich repeat 752..770 CDD:275380
SEFIR 870..1009 CDD:474043
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.