DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and NBP2

DIOPT Version :10

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_010446.3 Gene:NBP2 / 851740 SGDID:S000002569 Length:236 Species:Saccharomyces cerevisiae


Alignment Length:67 Identity:20/67 - (29%)
Similarity:37/67 - (55%) Gaps:7/67 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 VPKNFI--EKVVAIYDYYADKDDELSFQESSVLYVLKKNDDGWW--EGVMDGVTGLFPG---NYV 473
            :|.::|  ::.||:||:..:.|:||...|..::::..|:..||.  |......|||.|.   :|:
Yeast   105 LPDDYIVNQRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYI 169

  Fly   474 EP 475
            :|
Yeast   170 QP 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:462279
SH3_Abi 423..474 CDD:212760 17/55 (31%)
NBP2NP_010446.3 SH3_Nbp2-like 114..168 CDD:212799 16/53 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.