DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and ABIL4

DIOPT Version :9

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001330354.1 Gene:ABIL4 / 834208 AraportID:AT5G42030 Length:322 Species:Arabidopsis thaliana


Alignment Length:225 Identity:46/225 - (20%)
Similarity:76/225 - (33%) Gaps:78/225 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLTETPMA-----SENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALE 60
            |.:.|.:|     |.| .|||......:..:..:.|::....|...|:|.|.:|.:|::|:..:|
plant     1 MASSTSLAIVLHQSSN-HDELFMKQTLQFSETLKDLKNLRKQLYSAAEYFETSYGKAEHKETVIE 64

  Fly    61 ATKNY-------TTQSLASVAYQINT--------LAYSYMQLLELQAQQLGEMESQMNHIAQTVH 110
            ..|.|       |...|.||:.:.|:        .:.::::|..|: |::......|.......|
plant    65 TLKEYAAKAVVNTVDHLGSVSDKFNSFLSDNSTHFSTTHLRLSSLE-QRMRLCRDYMGKSGTHQH 128

  Fly   111 I--------HKE----------------------------------KVARREIGVLTANKVSSRQ 133
            :        ||.                                  ..||:      |||..|..
plant   129 LLLFQYPRHHKRYFFPQQGRGTSFSAGDDSHRFTSAVRSTILENLPNTARK------ANKTGSFS 187

  Fly   134 FKIVAP-----INPEKPIKYVRKPIDYSML 158
            |   ||     ||...|.|....|:.:.:|
plant   188 F---APIVHNNINNRTPNKRSNSPMRFPLL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:400255 18/101 (18%)
SH3_Abi 423..474 CDD:212760
ABIL4NP_001330354.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10460
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.