DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and ABIL3

DIOPT Version :9

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_197819.2 Gene:ABIL3 / 832498 AraportID:AT5G24310 Length:321 Species:Arabidopsis thaliana


Alignment Length:329 Identity:66/329 - (20%)
Similarity:128/329 - (38%) Gaps:37/329 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PMASE-NIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQS 69
            ||..| :..||::........|..:.|::..|.|...|:|.|.:|...:.|:..:|..|:|..::
plant     8 PMPREASNYDEISMQQSMLFSDSLKDLKNLRTQLYSAAEYFELSYTNDEQKQIVVETLKDYAIKA 72

  Fly    70 LASVAYQINTLAYSYMQLLELQAQQLGEMESQMNHIAQTVHIHKEKVARREIGVLTANKVSSRQF 134
            |.:....:.::.|.....::.:..::...|.:::.|.|.:.:.:|.:         .::..|:|.
plant    73 LVNTVDHLGSVTYKVNDFVDEKVDEVAGTELRVSCIEQRLRMCQEYM---------DHEGRSQQS 128

  Fly   135 KIVAPINPEKPIKYVRKPIDYSMLDEIGHGINSAQHSQVRQKHRGSS-----HGSVQSLLPPSVG 194
            .::.  .|:...:|      :....||..|.|.|:...|.....|..     ..:|::.: ....
plant   129 LVID--TPKFHKRY------FLPSGEIKRGGNLAKLKNVEGSFDGEDDWNQFRNAVRATI-RETP 184

  Fly   195 PPPTTKP-PTPPQMSRAGNTGTLGKSVSNTGTLGKSSREYRTPPVVNPPQVPSHYAPNYPIGHPK 258
            |||..|| ...|...:...:.|.  |.|:..|..|..::.|   .|:|.:.|...:.:..| .|.
plant   185 PPPVRKPILQSPSQRKPQRSATF--SFSSIATAPKKEQDKR---AVSPHRFPLLRSGSVAI-RPS 243

  Fly   259 RMS----TASSTMTTTTTGGGAAGNERAAGYSALPMPPSQQIATHVNLPSAG--MMQSLPPPPPT 317
            .:|    .:.|...|.|.....:...|:|.........:|:...|...||..  ::::|.....|
plant   244 SISRPTTPSKSRAVTPTPKRYPSEPRRSASVRVAFEKEAQKEPEHQQQPSKSKRLLKALLSRRKT 308

  Fly   318 TYDD 321
            ..||
plant   309 KKDD 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:400255 11/62 (18%)
SH3_Abi 423..474 CDD:212760
ABIL3NP_197819.2 PHA03247 <173..274 CDD:223021 24/107 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10460
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.