DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and ABIL1

DIOPT Version :9

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001118534.1 Gene:ABIL1 / 819230 AraportID:AT2G46225 Length:329 Species:Arabidopsis thaliana


Alignment Length:360 Identity:73/360 - (20%)
Similarity:131/360 - (36%) Gaps:87/360 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAALEATKNYTTQSLASVAYQI 77
            :||::...........|.|::....|...|||||.:|..::.|:..|:..|:||.::|.:....:
plant    15 LDEVSMERNKSFVKALQELKNLRPQLYSAADYCEKSYLHSEQKQMVLDNLKDYTVKALVNAVDHL 79

  Fly    78 NTLAYSYMQLLELQAQQLGEMESQMNHIAQ---TVHIHKEKVARREIGVLTANKVSSRQFKIVAP 139
            .|:|.....|.:.|...:..||.:.:.::|   |...:.:|...|:           :|...|.|
plant    80 GTVASKLTDLFDHQNSDISTMEMRASCVSQQLLTCRTYIDKEGLRQ-----------QQLLAVIP 133

  Fly   140 INPEKPI--KYVRKPIDYSMLDEIGHGINSAQHSQVRQKH-----RGSSHGSVQSLLPPSVGPPP 197
            ::.:..|  ..|.|.:.:|.|          :.:..||.|     |....|::.|.|...|    
plant   134 LHHKHYILPNSVNKRVHFSPL----------RRTDTRQNHYQAISRLQPSGAMSSSLSLLV---- 184

  Fly   198 TTKPPTPPQMSRAGNTGT-LGKSVSNTGTLGKSSREYRTPPVVNPPQVPSHYAPNYPIGHPKRMS 261
                         .||.: :..|:||  .||.:..:           .|:..:.::.:|...: |
plant   185 -------------NNTSSQISNSLSN--MLGLTHLD-----------APASKSLSWHLGSETK-S 222

  Fly   262 TASSTMTTTTTGGGAAGNERAAGYSALPMPPSQQIATHVNLPSAGMMQSLPPPPPTTYDDRSSMP 326
            |...|.|...:...:....:.:|...| :...:.||.  ..|.||...|..|...|.:.|..   
plant   223 TLKGTSTVAPSSKDSKAFSKTSGVFHL-LGDDENIAN--KKPLAGSQVSGVPAASTAHKDLE--- 281

  Fly   327 PAPPSPLTVSQHEMTEQSHIGMHTLGRNINRNPNR 361
                .|..::.|              |:::.||.|
plant   282 ----VPKLLTAH--------------RSLDNNPRR 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:400255 12/67 (18%)
SH3_Abi 423..474 CDD:212760
ABIL1NP_001118534.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2546
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10460
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.