DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Abi and Exn

DIOPT Version :10

Sequence 1:NP_001247091.1 Gene:Abi / 41718 FlyBaseID:FBgn0020510 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001097630.2 Gene:Exn / 39900 FlyBaseID:FBgn0261547 Length:2029 Species:Drosophila melanogaster


Alignment Length:156 Identity:40/156 - (25%)
Similarity:60/156 - (38%) Gaps:37/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 SMPPAPPSPLTVSQHEMTEQSHIGMHTLGRNINRNPNRNHFSLNFARP--GSQSPPLPPPPPPED 386
            |:|..|...|         :...|.:.:...:..|.:|....|..:.|  ..|...|....|||.
  Fly  1874 SLPQLPTKDL---------KDQAGKNLILMTLLENCDRKTVELVLSCPSVSDQQRWLQAMRPPEA 1929

  Fly   387 EHQDFGRPRTSTGPQLAPIVPEDQNLPGW-VPKNFIEKVVAIYDYYADKDDELSFQESSVLYVLK 450
            |                  .|.::....| .|     :|||.:.|.:|:.|.|..:...|:.|.:
  Fly  1930 E------------------TPGEKLYESWDCP-----QVVAKHSYESDEPDVLQLELGDVVNVSR 1971

  Fly   451 KNDDGWWEG--VMDGVTGLFPGNYVE 474
            |..|||::|  :.||..|.|||:|.|
  Fly  1972 KLPDGWYQGERIRDGAVGWFPGSYTE 1997

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AbiNP_001247091.1 Abi_HHR 105..168 CDD:462279
SH3_Abi 423..474 CDD:212760 21/52 (40%)
ExnNP_001097630.2 RhoGEF 1581..1762 CDD:459876
PH_ephexin 1805..1931 CDD:269929 15/83 (18%)
SH3_ephexin1_like 1944..1998 CDD:212727 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.