DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kif19A and CG32318

DIOPT Version :9

Sequence 1:NP_996208.1 Gene:Kif19A / 41717 FlyBaseID:FBgn0038205 Length:750 Species:Drosophila melanogaster
Sequence 2:NP_995952.1 Gene:CG32318 / 2768976 FlyBaseID:FBgn0052318 Length:164 Species:Drosophila melanogaster


Alignment Length:116 Identity:38/116 - (32%)
Similarity:55/116 - (47%) Gaps:24/116 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGGSNSSQGRSIATAQPAQEERLVVAVRVRPSMEATERCI------------EVISGGSLLYDDG 66
            |||:.|.|      .|....:.:.|.||||| :.:.||||            ||::..:|     
  Fly     4 SGGNTSRQ------PQKKSNQNIQVYVRVRP-LNSRERCIRSAEVVDVVGPREVVTRHTL----- 56

  Fly    67 GKSRPRQYSYDHVFRENDSQEQVYKTTTAPLVRDVLNGLNAAVFAYGATGS 117
            .....:::::|..|.....|..||....:||:.:||||.|..|||||.||:
  Fly    57 DSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGN 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kif19ANP_996208.1 Motor_domain 35..371 CDD:277568 32/95 (34%)
Kinesin 41..371 CDD:278646 30/89 (34%)
CG32318NP_995952.1 Motor_domain 17..>106 CDD:277568 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.