DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or19a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:404 Identity:81/404 - (20%)
Similarity:146/404 - (36%) Gaps:95/404 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRRNPVDNSMVNASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPAN--QNPPV------LSITI 88
            |.|:....|||            .||.|..|        .|:....|  |:..:      |.:|:
  Fly    33 WGRHYTAYSMV------------WNVTFHIC--------IWVSFSVNLLQSNSLETFCESLCVTM 77

  Fly    89 YFSIRGLMLYLKRKEIVEFVND------LDRECPRDLVSQLDMQMDETYRNFWQRYRFI--RIYS 145
            ..::..|.|...|:...:.::.      ||:....|...|:.|...|       |..||  .|:.
  Fly    78 PHTLYMLKLINVRRMRGQMISSHWLLRLLDKRLGCDDERQIIMAGIE-------RAEFIFRTIFR 135

  Fly   146 HLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSF 210
            .|.    |.|.|.:..::...:.|      .:...|:|...|...:.||   :..::.||..::.
  Fly   136 GLA----CTVVLGIIYISASSEPT------LMYPTWIPWNWRDSTSAYL---ATAMLHTTALMAN 187

  Fly   211 FVTFDNLFNVMQGHLVM---HLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKY 272
            .....||.:....:|::   |...||.:.|.:.....|.           .|:.|.:|.|....:
  Fly   188 ATLVLNLSSYPGTYLILVSVHTKALALRVSKLGYGAPLP-----------AVRMQAILVGYIHDH 241

  Fly   273 NDIFKV-----------AFL--VSNFVGAGSLCFYLFM----LSETSDVLIIAQYILPTLVLVGF 320
            ..|.::           .||  .|......::|::|..    :....::|.:...:....:|:.:
  Fly   242 QIILRLFKSLERSLSMTCFLQFFSTACAQCTICYFLLFGNVGIMRFMNMLFLLVILTTETLLLCY 306

  Fly   321 TFEI-CLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHF 384
            |.|: |       |..|.|.:::.|..|...|..:|:..||....||....|.:..::.::|..|
  Fly   307 TAELPC-------KEGESLLTAVYSCNWLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTF 364

  Fly   385 TEIMQLAYRLFTFL 398
            |.:::.||.:.|.|
  Fly   365 TVMIKGAYTMLTLL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 67/353 (19%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 65/344 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.