DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or94b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:339 Identity:68/339 - (20%)
Similarity:137/339 - (40%) Gaps:62/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IYFSIRGLML-------YLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRYR--FIRI 143
            :|.||..|.|       :.:|.|....:::|..:...:|.:..:::       |||:.:  |.||
  Fly    74 LYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIK-------FWQQNQRNFKRI 131

  Fly   144 -YSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVR-KDPNFYLLVWSFDLMC-TT 205
             |.::.|.:|..|...:.:...|..:.|       .|.::|...| ::..||  .|.::::. |.
  Fly   132 FYWYIWGSLFVAVMGYISVFFQEDYELP-------FGYYVPFEWRTRERYFY--AWGYNVVAMTL 187

  Fly   206 CGVSFFVTFDNLFNVMQGHLVMHLGHLARQFS-AIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLC 269
            |.:|     :.|.:.:..:.:.|:..|.|... .::..::..:||. ..:||.:.|....:..|.
  Fly   188 CCLS-----NILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKA-RPELRRIFQLHTKVRRLT 246

  Fly   270 RKYNDIFKVAFLVSNFV-GAGSLCFY--------------LFMLSETSDVLIIAQYILPTLVLVG 319
            |:. ::....:::|..| .|..:||.              ||:.:.....::|.|..||      
  Fly   247 REC-EVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLFVTTVQFVAVMIVQIFLP------ 304

  Fly   320 FTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHF 384
                 |..|.:|...:..|.:|:....|...|...||....:.::.:|..::.|....::.:..|
  Fly   305 -----CYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIF 364

  Fly   385 TEIMQLAYRLFTFL 398
            .:.:..||..|..|
  Fly   365 VKTINNAYSFFALL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/331 (19%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 64/331 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.