DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or85e

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001262374.1 Gene:Or85e / 41018 FlyBaseID:FBgn0026399 Length:467 Species:Drosophila melanogaster


Alignment Length:426 Identity:90/426 - (21%)
Similarity:153/426 - (35%) Gaps:108/426 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQNPPV---LSITIYFSIRGL-MLY--LKRKE 103
            |||.| .|..|.|||.... .|::       |..:...:   |::||.:...|. .:|  |:.:.
  Fly    68 SMVIF-TSLHLGVLFTKTT-LDVL-------PTGELQAITDALTMTIIYFFTGYGTIYWCLRSRR 123

  Fly   104 IVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRYRFIRIYSHLGGPM-FCVVPLALFLLTHEGK 167
            ::.::..::||.....::.:............:.:..:.|.|.|.|.: :.|.||.|.:     :
  Fly   124 LLAYMEHMNREYRHHSLAGVTFVSSHAAFRMSRNFTVVWIMSCLLGVISWGVSPLMLGI-----R 183

  Fly   168 DTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDL-------MCTTCGVSFFVT--------FDNL 217
            ..|       |..|.|... ..|..|..|::..|       |....|.|.|||        ||.|
  Fly   184 MLP-------LQCWYPFDA-LGPGTYTAVYATQLFGQIMVGMTFGFGGSLFVTLSLLLLGQFDVL 240

  Fly   218 F---NVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCR--------- 270
            :   ..:..|..:..|......|::.....|.|.||   :|...|..|:....|.|         
  Fly   241 YCSLKNLDAHTKLLGGESVNGLSSLQEELLLGDSKR---ELNQYVLLQEHPTDLLRLSAGRKCPD 302

  Fly   271 ------------------------KYNDIFKVAFLVSNFVGAGSLCFYLFM-LSETSDVLIIA-- 308
                                    :..::|....||.:......||..:|: :|.|.:||.|.  
  Fly   303 QGNAFHNALVECIRLHRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSGTREVLRIVNQ 367

  Fly   309 -QYI-LPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQE------WYLGSRRYRKFYLLWTQYC 365
             ||: |....|:.||:  |  |..|.:      .|:||.:      |:..:...|:..|::....
  Fly   368 LQYLGLTIFELLMFTY--C--GELLSR------HSIRSGDAFWRGAWWKHAHFIRQDILIFLVNS 422

  Fly   366 QRTQQL--GAFGLIQVNMVHFTEIMQLAYRLFTFLK 399
            :|...:  |.|.::.||.:.  .::..|:...|.|:
  Fly   423 RRAVHVTAGKFYVMDVNRLR--SVITQAFSFLTLLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 77/387 (20%)
Or85eNP_001262374.1 7tm_6 120..449 CDD:251636 70/356 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.