DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or85d

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:416 Identity:88/416 - (21%)
Similarity:168/416 - (40%) Gaps:104/416 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAQMVHFQWRRNPVDNSMVNASMVPFC--------LSAFLNVLFFGCNGWDIIGHFWLGHPANQN 80
            :||||:       ::..:::..:..|.        |.|.:|:.|.   |:.|:|.|.:.:.:.| 
  Fly    58 IAQMVN-------LNTVLISELIYVFLAIGKGSNFLEATMNLSFI---GFVIVGDFKIWNISRQ- 111

  Fly    81 PPVLSITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQ---------------------LD 124
                                ||.:.:.|:.|:...|:.|..|                     :.
  Fly   112 --------------------RKRLTQVVSRLEELHPQGLAQQEPYNIGHHLSGYSRYSKFYFGMH 156

  Fly   125 MQMDETYRNFWQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLG--GWLPCGVR 187
            |.:..||..:|..|..:           |...|.:            .|.|::|.  .|:|....
  Fly   157 MVLIWTYNLYWAVYYLV-----------CDFWLGM------------RQFERMLPYYCWVPWDWS 198

  Fly   188 KDPNFYLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVMHL----GHLARQFSAIDPRQSLTDE 248
            ...::|.:..|.::....| :|..:..|.|...:...:|||.    .|:....:.|.   |...:
  Fly   199 TGYSYYFMYISQNIGGQAC-LSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGIG---SFQHD 259

  Fly   249 KRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAG-SLCFYLFML---SETSDVLIIAQ 309
            ..|   |:..|...|.|..||:..|:||.|: |:||||.:. .:||..|.:   |:..:::::..
  Fly   260 LEF---LQATVAYHQSLIHLCQDINEIFGVS-LLSNFVSSSFIICFVGFQMTIGSKIDNLVMLVL 320

  Fly   310 YILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAF 374
            ::...:|.|   |.|.....:|..|||.:..::.:.:|:....||||..:|..:..|:..:|.|.
  Fly   321 FLFCAMVQV---FMIATHAQRLVDASEQIGQAVYNHDWFRADLRYRKMLILIIKRAQQPSRLKAT 382

  Fly   375 GLIQVNMVHFTEIMQLAYRLFTFLKS 400
            ..:.:::|..::::||:|:.|..|::
  Fly   383 MFLNISLVTVSDLLQLSYKFFALLRT 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 72/347 (21%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 80/373 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472800
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.