DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or85b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:431 Identity:92/431 - (21%)
Similarity:159/431 - (36%) Gaps:107/431 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LRPQMFQEVAQM----VHFQWRRNPVDNSMVNASMVPFCLSAFLNVLFF-GCNGWDIIGHFWLGH 75
            :||....|.::|    .|..:..|.::.|.|......:..|||::..|. .......||...:| 
  Fly    17 IRPYTNGEESKMNKLIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVG- 80

  Fly    76 PANQNPPVLSITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRY-- 138
                      ::..|.||     .|:..|.|.:|:|....|..|:.:             :||  
  Fly    81 ----------MSKMFFIR-----WKKTAITELINELKEIYPNGLIRE-------------ERYNL 117

  Fly   139 --------RFIRIYSHLGG------PMFCVVPLALF----LLTHEGKDTPVAQHEQLLGGWLPCG 185
                    |...|||.|..      .:|||:...::    .:...||..|...       ::|..
  Fly   118 PMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLM-------YIPWK 175

  Fly   186 VRKDPNFYLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKR 250
            .:.:.::|.|::|.:....|.......| |.|...:...||||...|:......:.......:.|
  Fly   176 WQDNWSYYPLLFSQNFAGYTSAAGQIST-DVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSR 239

  Fly   251 FFVDLRLLVQRQQLLNGLCRKYNDIFKVA----FLVSNFVGAGSLCF-----------------Y 294
            |.||   :|:..:.:..|....||||.:.    |:||:||    :||                 :
  Fly   240 FLVD---IVRYHERILRLSDAVNDIFGIPLLLNFMVSSFV----ICFVGFQMTVGVPPDIVVKLF 297

  Fly   295 LFMLSETSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYL 359
            ||::|..|.|.:|..|                 |..:..||.|...:..:|:||....||::..:
  Fly   298 LFLVSSMSQVYLICHY-----------------GQLVADASYGFSVATYNQKWYKADVRYKRALV 345

  Fly   360 LWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400
            :.....|:...|.|...:.:.....|:::|::|:.|..|::
  Fly   346 IIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 74/357 (21%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 78/374 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472797
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.