DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Orco

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:160 Identity:32/160 - (20%)
Similarity:62/160 - (38%) Gaps:22/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 LVQRQQLLNGLCRKY-----NDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQ-------- 309
            |.::|:::.....||     ..:.::...:.:..||..|   |.||:.|..:.::|.        
  Fly   326 LTKKQEMMVRSAIKYWVERHKHVVRLVAAIGDTYGAALL---LHMLTSTIKLTLLAYQATKINGV 387

  Fly   310 --YILPTLVLVGF----TFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRT 368
              |....:..:|:    .|..|:.|.:|.:.|..:..:..|..||.||...:.|..:..|.||:.
  Fly   388 NVYAFTVVGYLGYALAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKA 452

  Fly   369 QQLGAFGLIQVNMVHFTEIMQLAYRLFTFL 398
            ..:.......|::..|..::......|..|
  Fly   453 MSISGAKFFTVSLDLFASVLGAVVTYFMVL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 30/152 (20%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 30/148 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.