DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or67b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:412 Identity:86/412 - (20%)
Similarity:155/412 - (37%) Gaps:103/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MVHFQWRRNPVDNSMVNASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQNPPVLSITIYFS 91
            |:.|:        :.|.|.::.|.||..:..:|          ||       ||.......:.||
  Fly    71 MISFE--------TYVEAVLLTFQLSVGVVKMF----------HF-------QNKVESCSQLVFS 110

  Fly    92 IR-GLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFW-----QRYRFIRIYSHLGGP 150
            .. |.:|    |.:..|..||.|:  ::|:|.:.:.:    .|.|     |...|.:|...   |
  Fly   111 TETGEVL----KSLGLFQLDLPRK--KELLSSVSLIL----LNNWMIIDRQVMFFFKIVCM---P 162

  Fly   151 M--FCVVPLALFLLTHEGKDTPVAQHE---QLLGGWLPCGVRKDPNF---YLLVWSFDLMCTTCG 207
            :  :||.|...::.....||....:..   ..:..:|..|..:.|::   :.|:.|..|.|    
  Fly   163 VLYYCVRPYFQYIFDCYIKDKDTCEMTLTYPAIVPYLQLGNYEFPSYVIRFFLLQSGPLWC---- 223

  Fly   208 VSFFVT--FDNLFNVM---QGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNG 267
              ||..  |::||.|:   :..|:..|..|.         |:.|.:        :||.:.|.:..
  Fly   224 --FFAVFGFNSLFVVLTRYESGLIKVLRFLV---------QNSTSD--------ILVPKDQRVKY 269

  Fly   268 L--C-----------RKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLVG 319
            |  |           .:..::||...||...|.:..:|..|:.:|...:|    .::...:::|.
  Fly   270 LQCCVRLFARISSHHNQIENLFKYIILVQCSVSSILICMLLYKISTVLEV----GWVWMGMIMVY 330

  Fly   320 F---TFEICL---RGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQ 378
            |   ..||.|   ...::|..||.|.....:..||..||.::....:...:.:||..|...|...
  Fly   331 FVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKFMIKMMLLFSRRTFVLSVGGFTS 395

  Fly   379 VNMVHFTEIMQLAYRLFTFLKS 400
            ::.....::.:|:...|..|::
  Fly   396 LSHKFLVQVFRLSANFFLLLRN 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 74/354 (21%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 49/237 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.