DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or63a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:326 Identity:66/326 - (20%)
Similarity:131/326 - (40%) Gaps:47/326 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 LKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFW---QRYRFIRIYSHLGGPMFC------- 153
            |::.|:.|.::||      .::.::..|::.|...:|   :|...|.:||     ..|       
  Fly   114 LQKCELFERMSDL------PVIKEIRQQVESTMNRYWASTRRQILIYLYS-----CICITTNYFI 167

  Fly   154 ---VVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTFD 215
               |:.|..:....:|....:.....|...|...|: :.|.:::.::........||:. .|:||
  Fly   168 NSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGL-EFPYYHIQMYLETCSLYICGMC-AVSFD 230

  Fly   216 NLFNVMQGH---LVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFK 277
            .:|.|:..|   |:..|..:..|.::     .|....|....||..:.:.|.:.....:.|:.|:
  Fly   231 GVFIVLCLHSVGLMRSLNQMVEQATS-----ELVPPDRRVEYLRCCIYQYQRVANFATEVNNCFR 290

  Fly   278 ----VAFLVSNFVGAGSLCFYLFM-LSETSDVLIIAQYILPTLVLVGFTFEI---CLRGTQLEKA 334
                ..||:|.| ..|...|.:.: |...|.:.:|..    |:.||...::|   |..|.:...|
  Fly   291 HITFTQFLLSLF-NWGLALFQMSVGLGNNSSITMIRM----TMYLVAAGYQIVVYCYNGQRFATA 350

  Fly   335 SEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLK 399
            ||.:.::.....||..||.:|....:......|..:|.....:|:::.....:::.:.:.|..|:
  Fly   351 SEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVRTSGQYFLLLQ 415

  Fly   400 S 400
            :
  Fly   416 N 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/316 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 64/316 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.