DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or59a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:421 Identity:79/421 - (18%)
Similarity:154/421 - (36%) Gaps:119/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MVHFQ---WRRNPVDNSMVNASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQ--NPPVLSI 86
            :.||:   |:...|..|:|:..:|..|....|.:..|                .|:  ...:|::
  Fly    24 VAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLF----------------RNRTITEDILNL 72

  Fly    87 TIY-----FSIRGLMLYLKRKEIVE---FVNDLDREC----PRDLVSQLDMQMDETYRNFWQRYR 139
            |.:     .|::.|:.....|:::|   .:..||...    .|.:..|:.:|:    ||.  .|.
  Fly    73 TTFATCTACSVKCLLYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQL----RNV--LYV 131

  Fly   140 FIRIYSHLGGPMFCVVPLALFL-LTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMC 203
            ||.||          :|.|||. |:...|:    :...:...|.|.........|.:..::.:: 
  Fly   132 FIGIY----------MPCALFAELSFLFKE----ERGLMYPAWFPFDWLHSTRNYYIANAYQIV- 181

  Fly   204 TTCGVSFFVTFDNLFNVMQGH------------LVMHLGHLARQFS--AIDPRQS--------LT 246
               |:|        |.::|.:            :..|:..|..:|.  .:||.:.        :|
  Fly   182 ---GIS--------FQLLQNYVSDCFPAVVLCLISSHIKMLYNRFEEVGLDPARDAEKDLEACIT 235

  Fly   247 DEKRF---------FVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETS 302
            |.|..         |:.|.:|:|.......:|                :|..:|.|::      |
  Fly   236 DHKHILELFRRIEAFISLPMLIQFTVTALNVC----------------IGLAALVFFV------S 278

  Fly   303 DVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQR 367
            :.:....:|..:|.:....|..|..||..|.....|..:..|..|:..:|.:::..:|:.:...:
  Fly   279 EPMARMYFIFYSLAMPLQIFPSCFFGTDNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLK 343

  Fly   368 TQQLGAFGLIQVNMVHFTEIMQLAYRLFTFL 398
            .....|.|::::::..|...::.||.|||.:
  Fly   344 KSTAVAGGMMRIHLDTFFSTLKGAYSLFTII 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/362 (18%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 63/357 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.