DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or56a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:409 Identity:78/409 - (19%)
Similarity:150/409 - (36%) Gaps:101/409 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 WLGHPA--NQNPPVLSI---TI-----------------------------------YFSIRGLM 96
            |.|:.|  :||.|:||:   ||                                   ||::...|
  Fly    28 WYGYVASKDQNRPLLSLIRCTILTASIWLSCALMLARVFRGYENLNDGATSYATAVQYFAVSIAM 92

  Fly    97 L--YLKRKEIVEFV----NDLDRECPRDLVSQLD-MQMDETYRNFWQRYR-----FIRIYSHLGG 149
            .  |::|.:::..:    :|:     ::|:.:.| .:|:.....  |.|.     .|.|.|.:.|
  Fly    93 FNAYVQRDKVISLLRVAHSDI-----QNLMHEADNREMELLVAT--QAYTRTITLLIWIPSVIAG 150

  Fly   150 PMF---CV-----VPLALFLL--THEGKDTPVAQHEQLLGGWLPCGVRKDPNF---YLLVWSFDL 201
            .|.   |:     :|.::|.:  ...|::.|:     ||....|.|...| ||   ||..|    
  Fly   151 LMAYSDCIYRSLFLPKSVFNVPAVRRGEEHPI-----LLFQLFPFGELCD-NFVVGYLGPW---- 205

  Fly   202 MCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAIDPRQ--------SLTDEKRFFVDLRL- 257
            .....|::....:......:..::.:.|..|.::...:|..:        .||..:..|..::| 
  Fly   206 YALGLGITAIPLWHTFITCLMKYVNLKLQILNKRVEEMDITRLNSKLVIGRLTASELTFWQMQLF 270

  Fly   258 --LVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLS----ETSDVLIIAQYILPTLV 316
              .|:.|..:....::...:..|..:....:.:..:||..|.|:    ...|...:..|:   .|
  Fly   271 KEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTVGVPSKMDYFFMFIYL---FV 332

  Fly   317 LVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNM 381
            :.|..:......|.:.:..:.|..:..|..||......:|..:....:.||..::.|. |:.:|:
  Fly   333 MAGILWIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQKMLVFMMMHAQRPMKMRAL-LVDLNL 396

  Fly   382 VHFTEIMQLAYRLFTFLKS 400
            ..|.:|.:.||..|..|:|
  Fly   397 RTFIDIGRGAYSYFNLLRS 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 71/396 (18%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 54/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.