DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or45a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523666.3 Gene:Or45a / 35958 FlyBaseID:FBgn0033404 Length:378 Species:Drosophila melanogaster


Alignment Length:337 Identity:63/337 - (18%)
Similarity:125/337 - (37%) Gaps:66/337 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IIGHFW--LGHPANQNPPVLSITIYFSI---------RGLMLYLKRKEIVEFVNDLDR------E 114
            :|.|.|  :.:.......:..:|..|::         :.|::..||:.|...::.|.:      .
  Fly    40 LISHNWPMVVYALQDLSDLTRLTDNFAVFMQGSQSTFKFLVMMAKRRRIGSLIHRLHKLNQAASA 104

  Fly   115 CPRDL-----VSQLDMQMDETYRNFWQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQH 174
            .|..|     .:|||..:..::||        ..|..:.......:.|.|:.....|..||....
  Fly   105 TPNHLEKIERENQLDRYVARSFRN--------AAYGVICASAIAPMLLGLWGYVETGVFTPTTPM 161

  Fly   175 EQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAI 239
            |  ...||.   .:.|:||..::.:.::.........:..|.||:.:..::|:       ||..:
  Fly   162 E--FNFWLD---ERKPHFYWPIYVWGVLGVAAAAWLAIATDTLFSWLTHNVVI-------QFQLL 214

  Fly   240 DPRQSLTDEKRFFVDL-----RL--LVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFM 297
               :.:.:||    ||     ||  .|.|.::...|.::.:.||.....|...:....||...|.
  Fly   215 ---ELVLEEK----DLNGGDSRLTGFVSRHRIALDLAKELSSIFGEIVFVKYMLSYLQLCMLAFR 272

  Fly   298 LSE---TSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQ-EWYLGSRRYRKFY 358
            .|.   ::.|...|.:::..::.:.   ..|..|..:::.|..:..::..| .|...:.:.|:  
  Fly   273 FSRSGWSAQVPFRATFLVAIIIQLS---SYCYGGEYIKQQSLAIAQAVYGQINWPEMTPKKRR-- 332

  Fly   359 LLWTQYCQRTQQ 370
             ||.....|.|:
  Fly   333 -LWQMVIMRAQR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 60/327 (18%)
Or45aNP_523666.3 7tm_6 64..367 CDD:251636 59/313 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.