DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or43b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523656.2 Gene:Or43b / 35743 FlyBaseID:FBgn0026393 Length:403 Species:Drosophila melanogaster


Alignment Length:420 Identity:73/420 - (17%)
Similarity:151/420 - (35%) Gaps:108/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PVDNSMVNASMVPFCLSAFLNV---LFFGCNGWDIIGHFW------LGHPAN------QNPPVLS 85
            |:.:...||.|:....::.||:   ...|...|.:....:      :..|.|      :.||.|.
  Fly    16 PIQSRDSNAYMMETLRNSGLNLKNDFGIGRKIWRVFSFTYNMVILPVSFPINYVIHLAEFPPELL 80

  Fly    86 I--------TIYFSIR--GLMLYLKRKEIV-EFVNDLDREC--------PRDLVSQLDMQMDETY 131
            :        |..|:::  .|::|..|.|:. :..::||:.|        .||:|:.:        
  Fly    81 LQSLQLCLNTWCFALKFFTLIVYTHRLELANKHFDELDKYCVKPAEKRKVRDMVATI-------- 137

  Fly   132 RNFWQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLV 196
                     .|:|      :..||...|:..:            .||.|.|...|..:..:..:.
  Fly   138 ---------TRLY------LTFVVVYVLYATS------------TLLDGLLHHRVPYNTYYPFIN 175

  Fly   197 WSFD---------LMCTTCGVSFFV-TFDNLFNV-----MQGHL------VMHLGHLARQFSAID 240
            |..|         |...|.|.:.:| |..:.:.|     ::.|:      :::||         |
  Fly   176 WRVDRTQMYIQSFLEYFTVGYAIYVATATDSYPVIYVAALRTHILLLKDRIIYLG---------D 231

  Fly   241 P-RQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGS----LCFYLFMLSE 300
            | .:..:|....|..|...::..:.:...|.....|.. ..:.:.|:..||    :...:.:.::
  Fly   232 PSNEGSSDPSYMFKSLVDCIKAHRTMLNFCDAIQPIIS-GTIFAQFIICGSILGIIMINMVLFAD 295

  Fly   301 TSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYC 365
            .|....|..|::..|:.   ||.:|.....:....:.|..:|....|::..:||::..:.:.|..
  Fly   296 QSTRFGIVIYVMAVLLQ---TFPLCFYCNAIVDDCKELAHALFHSAWWVQDKRYQRTVIQFLQKL 357

  Fly   366 QRTQQLGAFGLIQVNMVHFTEIMQLAYRLF 395
            |:.....|..:..:|:.....:.:.|:.::
  Fly   358 QQPMTFTAMNIFNINLATNINVAKFAFTVY 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/367 (17%)
Or43bNP_523656.2 7tm_6 95..384 CDD:251636 57/336 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.