DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or42b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:179 Identity:36/179 - (20%)
Similarity:76/179 - (42%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 HLGHLARQFSAIDPRQSLTDEKRF------FVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFV 286
            ||..|..:...:...::|::.:.:      .:|.:|:::...::..:.:  ..||....|:...:
  Fly   218 HLDMLRERIRRLRSDENLSEAESYEELVKCVMDHKLILRYCAIIKPVIQ--GTIFTQFLLIGLVL 280

  Fly   287 GAGSLCFYLFMLSETSDVLI-IAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLG 350
            |...:..:.|     ||:.. ||.::....:|:. ||..|.....:.:..|.|..::....|...
  Fly   281 GFTLINVFFF-----SDIWTGIASFMFVITILLQ-TFPFCYTCNLIMEDCESLTHAIFQSNWVDA 339

  Fly   351 SRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLK 399
            ||||:...|.:.|..|:.....|.|:.|::|.....:.:.|:.:.|..|
  Fly   340 SRRYKTTLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 33/170 (19%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 33/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465957
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.