DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or35a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:451 Identity:73/451 - (16%)
Similarity:149/451 - (33%) Gaps:145/451 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VAQMVHFQWRRNPVDNSMVN-ASMVPFCLSAFLNVLFFGCNGWDIIGHFWLGHPANQN------- 80
            |.::.|..|   |:|.|... ...:...|:..::::|...|..::  .:.....:|:|       
  Fly    22 VFRLNHIFW---PLDPSTGKWGRYLDKVLAVAMSLVFMQHNDAEL--RYLRFEASNRNLDAFLTG 81

  Fly    81 PPVLSITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMD-----ETYRNFWQRYRF 140
            .|...|.:....|.|.:.|..:::.:|:.          :...::.:|     |.:|....:...
  Fly    82 MPTYLILVEAQFRSLHILLHFEKLQKFLE----------IFYANIYIDPRKEPEMFRKVDGKMII 136

  Fly   141 IRIYSHLGGPMFCVVPLA-LFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFD---- 200
            .|:.|.:.|.:..:..:| :|.:.::.||.                      .|.:::.||    
  Fly   137 NRLVSAMYGAVISLYLIAPVFSIINQSKDF----------------------LYSMIFPFDSDPL 179

  Fly   201 -----LMCTTCGVSFFVTFDNLFNVMQG------HLVMHLGH----LARQFS-AIDPRQSLTDEK 249
                 |:.|...|...:.     .:|.|      .|::||..    |.|... ||:......|..
  Fly   180 YIFVPLLLTNVWVGIVID-----TMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVARDRP 239

  Fly   250 RFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFV----GAGSLCF------------YLFML 298
            .....|::|:.:....|....::....:..:.|..|:    .||.||.            |::.:
  Fly   240 HMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNPMANYIYAI 304

  Fly   299 ---SETSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEW-----YLGS---- 351
               ::|.::|.:.|.                 |:.|...::.|.:......|     |..:    
  Fly   305 WFGAKTVELLSLGQI-----------------GSDLAFTTDSLSTMYYLTHWEQILQYSTNPSEN 352

  Fly   352 ------------RRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400
                        ...:.||:...:|.:.:.|.|            .:|:|.::..||||.|
  Fly   353 LRLLKLINLAIEMNSKPFYVTGLKYFRVSLQAG------------LKILQASFSYFTFLTS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 59/389 (15%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 58/384 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472813
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.