DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or23a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523458.3 Gene:Or23a / 33450 FlyBaseID:FBgn0026395 Length:379 Species:Drosophila melanogaster


Alignment Length:407 Identity:78/407 - (19%)
Similarity:147/407 - (36%) Gaps:97/407 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LSAFLNVLFF--GCNGWDII-------GHFW-----------LGHPA------NQNPPV-----L 84
            ||..|.:.:|  ..|.|.|.       |.:|           |..|.      :...||     |
  Fly     3 LSETLKIDYFRVQLNAWRICGALDLSEGRYWSWSMLLCILVYLPTPMLLRGVYSFEDPVENNFSL 67

  Fly    85 SITIYFSIRGLM---LYLKR-KEIVEFVNDLDRECPRDLVSQLDMQM-----DETYRNFWQR-YR 139
            |:|: .|:..||   :|:.: .::||.         :.|:.|||.::     .|.:||..:. .|
  Fly    68 SLTV-TSLSNLMKFCMYVAQLTKMVEV---------QSLIGQLDARVSGESQSERHRNMTEHLLR 122

  Fly   140 FIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCT 204
            ..:::......:|.:..:.....|......|:         |.|           ..|. :.|..
  Fly   123 MSKLFQITYAVVFIIAAVPFVFETELSLPMPM---------WFP-----------FDWK-NSMVA 166

  Fly   205 TCGVSFFVTFDNLFNVMQ-------GHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQ 262
            ..|...|.....:|.:||       ..||::|  ::.|...:..|.|     ......:.|.:.:
  Fly   167 YIGALVFQEIGYVFQIMQCFAADSFPPLVLYL--ISEQCQLLILRIS-----EIGYGYKTLEENE 224

  Fly   263 QLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTL--------VLVG 319
            |.|....|..|.::::..:..:.|....:..::.:....:..|.:..:.:.||        .|:|
  Fly   225 QDLVNCIRDQNALYRLLDVTKSLVSYPMMVQFMVIGINIAITLFVLIFYVETLYDRIYYLCFLLG 289

  Fly   320 F---TFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNM 381
            .   |:.:|..||.::::...|..::....|...|..||...|:..:..:|.|.|.|..|:.:::
  Fly   290 ITVQTYPLCYYGTMVQESFAELHYAVFCSNWVDQSASYRGHMLILAERTKRMQLLLAGNLVPIHL 354

  Fly   382 VHFTEIMQLAYRLFTFL 398
            ..:....:.||..||.:
  Fly   355 STYVACWKGAYSFFTLM 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 64/355 (18%)
Or23aNP_523458.3 7tm_6 59..365 CDD:251636 63/343 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.