DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or22c

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:263 Identity:61/263 - (23%)
Similarity:92/263 - (34%) Gaps:51/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PMFC----VVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSF 210
            |.|.    |.||...|||..|..|..|  ...:.|:..|..     .|:           ||...
  Fly   177 PSFAVQPGVFPLTYVLLTASGACTVFA--FSFVDGFFICSC-----LYI-----------CGAFR 223

  Fly   211 FVTFD--NLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRL--LVQRQQLLNGLC-- 269
            .|..|  .:|..:.|                |.....|:|....|..||  :|:|...:...|  
  Fly   224 LVQQDIRRIFADLHG----------------DSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTD 272

  Fly   270 --RKYNDIFKVAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLVGFTFEICLRGTQLE 332
              |::..|..:.||.:.||...::...:...|..|.:..|. ||:..|..:   |..|..|..:.
  Fly   273 LTRQFTVIVLMHFLSAAFVLCSTILDIMLNTSSLSGLTYIC-YIIAALTQL---FLYCFGGNHVS 333

  Fly   333 KASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTF 397
            ::|..:...|...|||....|.||..|:..:..||.:.: |......::.....|:..|....|.
  Fly   334 ESSAAVADVLYDMEWYKCDARTRKVILMILRRSQRAKTI-AVPFFTPSLPALRSILSTAGSYITL 397

  Fly   398 LKS 400
            ||:
  Fly   398 LKT 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 57/253 (23%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.