DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or22b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:335 Identity:65/335 - (19%)
Similarity:124/335 - (37%) Gaps:63/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 SITIYFSIRGLMLYLKRKEIVEFVNDLDRECPRDLVSQLDMQMDETYRNFWQRY----RFIRIYS 145
            |...|.::.|   |.||:|....:::||:.|..|         :|  |....|:    .|..|:.
  Fly    97 SFKSYLTMMG---YKKRQEAKMSLDELDKRCVCD---------EE--RTIVHRHVALGNFCYIFY 147

  Fly   146 HLGGPMFCVVPLALFLLTHEGKDTPVAQHEQLLGGWLPCGVRKDP--NFY--------LLVWS-- 198
            |:....|.:.....|::             :.:..|.......||  .||        |..|:  
  Fly   148 HIAYTSFLISNFLSFIM-------------KRIHAWRMYFPYVDPEKQFYISSIAEVILRGWAVF 199

  Fly   199 FDLMCTTCGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQ 263
            .||....|.:...|       :.:.|:.:....|....|  :|.::   |..:..:|...|:..:
  Fly   200 MDLCTDVCPLISMV-------IARCHITLLKQRLRNLRS--EPGRT---EDEYLKELADCVRDHR 252

  Fly   264 LLNGLCRKYNDIFK----VAFLVSNFVGAGSLCFYLFMLSETSDVLIIAQYILPTLVLVGFTFEI 324
            |:.........:|.    |.||:...|...|:...:|..:.::.|.::   :..:.|.:. ||..
  Fly   253 LILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTGVAVV---LFMSCVSMQ-TFPF 313

  Fly   325 CLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQ 389
            |.....:....:.:..||...:|....|||:...:.:....|:...|.|.|:..::|.....:::
  Fly   314 CYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVK 378

  Fly   390 LAYRLFTFLK 399
            ||:.:.|.:|
  Fly   379 LAFTVVTIVK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 62/326 (19%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 62/326 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.