DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or10a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:418 Identity:81/418 - (19%)
Similarity:148/418 - (35%) Gaps:99/418 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LNVLFFGCN--GWDIIGHFWLGHPANQNP-------PVLSITIYFSIRGLMLYLKRKEIVEFVND 110
            |:|.||...  ..||:| :|.|...:..|       .:|:|.:...:...|.:|.|::|...:..
  Fly    14 LDVYFFAVPRLSLDIMG-YWPGKTGDTWPWRSLIHFAILAIGVATELHAGMCFLDRQQITLALET 77

  Fly   111 LDRECP--RDLVSQLDMQMDETYRN----FWQRYR-------------------------FIRIY 144
            |   ||  ...|:.|.|.:...:|.    .|.|.|                         .|..:
  Fly    78 L---CPAGTSAVTLLKMFLMLRFRQDLSIMWNRLRGLLFDPNWERPEQRDIRLKHSAMAARINFW 139

  Fly   145 SHLGGPMFC--------VVPLALFLLTHEGKDTPVAQHEQLLGGW-------LPCGVRKDPNF-- 192
            ....|...|        ::.:.|:|..         ::|..:  |       :|..:...|.|  
  Fly   140 PLSAGFFTCTTYNLKPILIAMILYLQN---------RYEDFV--WFTPFNMTMPKVLLNYPFFPL 193

  Fly   193 ---------YLLVWSFDLMCTTCGVSFFVTFDNLFNVMQGHLVM----HLGHLARQFSAIDPRQS 244
                     |:.::.|. .|......|......||.|:|..:..    :..||     .:.|.|.
  Fly   194 TYIFIAYTGYVTIFMFG-GCDGFYFEFCAHLSALFEVLQAEIESMFRPYTDHL-----ELSPVQL 252

  Fly   245 LTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFY--LFMLSETSDVLII 307
            ...|::    :|.::.|...:..|.|.:.|.:.:..| ::||.|..:..:  :.:|:..::.|..
  Fly   253 YILEQK----MRSVIIRHNAIIDLTRFFRDRYTIITL-AHFVSAAMVIGFSMVNLLTLGNNGLGA 312

  Fly   308 AQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLG 372
            ..|:..|:..:......|..||.:.::|.||..::.|..|.|...:.|:...|.....||...: 
  Fly   313 MLYVAYTVAALSQLLVYCYGGTLVAESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSM- 376

  Fly   373 AFGLIQVNMVHFTEIMQLAYRLFTFLKS 400
            |......::..|..|:|.:..:...:||
  Fly   377 AVPFFSPSLATFAAILQTSGSIIALVKS 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 70/386 (18%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 64/351 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.