DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or9a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_511107.1 Gene:Or9a / 31975 FlyBaseID:FBgn0030204 Length:392 Species:Drosophila melanogaster


Alignment Length:415 Identity:79/415 - (19%)
Similarity:148/415 - (35%) Gaps:113/415 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LNVLFFGCNGWDIIGHFWLGHPANQNPPVLSITI----YFSIRGLMLYLKRKEIVEFVNDLDREC 115
            :.:|.:.|.|.|:    |....||..|.:..:|:    .|.:   .::|...|.:..|:.|....
  Fly    19 VQILVYRCMGIDL----WSPTMANDRPWLTFVTMGPLFLFMV---PMFLAAHEYITQVSLLSDTL 76

  Fly   116 PRDLVSQLDMQMDETYRNF----WQRYRFIRIYSHLGGPMFCVVPLALFLLTHEGKDTPVA---- 172
            .....|.|      |...|    :.|..|:.:..|:..           :|..|.:..|.|    
  Fly    77 GSTFASML------TLVKFLLFCYHRKEFVGLIYHIRA-----------ILAKEIEVWPDAREII 124

  Fly   173 ----QHEQLLG--------------------GWLPCGVRKD------PN------------FYLL 195
                |.:|:|.                    |.:...:|.|      |:            ||:.
  Fly   125 EVENQSDQMLSLTYTRCFGLAGIFAALKPFVGIILSSIRGDEIHLELPHNGVYPYDLQVVMFYVP 189

  Fly   196 VWSFDLMCTTCGVSFFVTFDNL-----FNV-----MQGHLVMHLGHLARQFSAIDPRQSLTDEKR 250
            .:.:::|.:...|:..:..|:|     :||     :..|.::||           |.....:|..
  Fly   190 TYLWNVMASYSAVTMALCVDSLLFFFTYNVCAIFKIAKHRMIHL-----------PAVGGKEELE 243

  Fly   251 FFVDLRLLVQR-QQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSE----TSDVLIIAQY 310
            ..|.:.||.|: .|:.:.:..||..:..:.|    |:.|..:||..|.:::    ...:..||  
  Fly   244 GLVQVLLLHQKGLQIADHIADKYRPLIFLQF----FLSALQICFIGFQVADLFPNPQSLYFIA-- 302

  Fly   311 ILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFG 375
            .:.:|::..|.:..|  |..::.||....:.|....|...|...::..|:.....||..|:..: 
  Fly   303 FVGSLLIALFIYSKC--GENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQMKGY- 364

  Fly   376 LIQVNMVHFTEIMQLAYRLFTFLKS 400
            ..:.:|..|:.|::.|......|:|
  Fly   365 FFEASMATFSTIVRSAVSYIMMLRS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 71/385 (18%)
Or9aNP_511107.1 7tm_6 68..381 CDD:251636 64/349 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.