DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or82a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_730794.1 Gene:Or82a / 318778 FlyBaseID:FBgn0041621 Length:385 Species:Drosophila melanogaster


Alignment Length:314 Identity:64/314 - (20%)
Similarity:124/314 - (39%) Gaps:61/314 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 RNFWQR-YRFIRIY----SHLG-------------------GPMFCV---VPLALFLL------- 162
            ::||:. :||.:::    ||:.                   |..:||   :....|:|       
  Fly    86 KDFWEMIHRFRKMHEQSASHIPRYREGLDYVAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIG 150

  Fly   163 ------THEGKDTPVAQHEQLLGGWLPCGVRKDPNFYLLVWSFDLMCTTCGVSFFVTFDNLFNVM 221
                  |...|:.|:...       .|....:.|. |.:.:.:.::.|...|::....|.||...
  Fly   151 VCRWHGTTCDKELPMPMK-------FPFNDLESPG-YEVCFLYTVLVTVVVVAYASAVDGLFISF 207

  Fly   222 QGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLNGLCRKYNDIFKVA----FLV 282
            ..:|..|...|.||....:...|..|.:   :.|:.:|:...||..|.||...|:...    |::
  Fly   208 AINLRAHFQTLQRQIENWEFPSSEPDTQ---IRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVI 269

  Fly   283 SNFVGAGSLCFYLFM-LSETSDVLIIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQE 346
            :: :..|.:.:.|.. :....|:|:.|.: ..:::|..|.:  |..|..::..|..:::::|...
  Fly   270 TS-LQVGVIIYQLVTNMDSVMDLLLYASF-FGSIMLQLFIY--CYGGEIIKAESLQVDTAVRLSN 330

  Fly   347 WYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFLKS 400
            |:|.|.:.|....|.....|:...:.| |....::.:|..|.:.|..|.|.:||
  Fly   331 WHLASPKTRTSLSLIILQSQKEVLIRA-GFFVASLANFVGICRTALSLITLIKS 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 59/304 (19%)
Or82aNP_730794.1 7tm_6 65..374 CDD:251636 59/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.