DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or65b

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:401 Identity:83/401 - (20%)
Similarity:147/401 - (36%) Gaps:97/401 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 NSMVNASMVPFCLSAFLNVLFFGCN---------GWD---IIGHFWLGHPANQNPPVLSITIYFS 91
            :::|...||.|..|     :.||..         |.|   |:|.|:          ::..|.||.
  Fly    57 HTLVYIQMVIFFAS-----MSFGLTESMGDHVQMGRDLAFILGAFF----------IIFKTYYFC 106

  Fly    92 IRGLMLYLKRKEIVEFVNDLD------RECPRDLVSQLDMQMDETYRNFWQRYRFIRIYSHLGGP 150
            ..|       .|:.:.::|||      ::.|..:..|..           :|:.|:..:......
  Fly   107 WYG-------DELDQVISDLDALHPWAQKGPNPVEYQTG-----------KRWYFVMAFFLATSW 153

  Fly   151 MFCVVPLALFLLTHEGKDTPVAQHEQLLG-------GWLPCGVRKDPN--FYLLVWSFDLMCTT- 205
            .|.:..|.|.|:|     :|:..|:|.|.       .|....:....:  .||....|.:.|.| 
  Fly   154 SFFLCILLLLLIT-----SPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQSYFAVYCLTW 213

  Fly   206 --C--GVSFFVTFDNLFNVMQGHLVMHLGHLARQFSAIDPRQSLTDEKRFFVDLRLLVQRQQLLN 266
              |  |:|..:..:..|.:..  |.:.|..:.|....:...:..|:        ||:...|:::.
  Fly   214 LLCIEGLSICIYAEITFGIEV--LCLELRQIHRHNYGLQELRMETN--------RLVKLHQKIVE 268

  Fly   267 GLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLS------ETSDVLIIAQYILPTLVLVGFTFEIC 325
            .|.|. ||:|....::...|.     |.|..||      ...|..::||:.:..|:.:|......
  Fly   269 ILDRT-NDVFHGTLIMQMGVN-----FSLVSLSVLEAVEARKDPKVVAQFAVLMLLALGHLSMWS 327

  Fly   326 LRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQ---LGAFGLIQVNMVHFTEI 387
            ..|.||.:.|  |:.|..:.|.|..::..:..|.......:|.|.   :.|......|:::::.|
  Fly   328 YCGDQLSQKS--LQISEAAYEAYDPTKGSKDVYRDLCVIIRRGQDPLIMRASPFPSFNLINYSAI 390

  Fly   388 MQLAYRLFTFL 398
            :...|.:.|||
  Fly   391 LNQCYGILTFL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 67/345 (19%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 72/362 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.