DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or88a and Or2a

DIOPT Version :9

Sequence 1:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:147 Identity:33/147 - (22%)
Similarity:62/147 - (42%) Gaps:16/147 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 LRLLVQRQQLLNGLCRKYNDIFKVAFLVSNFVGAGSLCFYLFMLSE---TSDVLIIAQYILPTLV 316
            ||.::||  :|:..|       ...|:.|..|.......:|::..:   |:.::.|..:...||.
  Fly   260 LREIIQR--VLSVPC-------MAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLE 315

  Fly   317 LVGFTFEICLRGTQLEKASEGLESSLRSQEWYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNM 381
            :    |.||..|.::...||.|..:.....|.....::::..|......||...:.|...|.:::
  Fly   316 V----FVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSL 376

  Fly   382 VHFTEIMQLAYRLFTFL 398
            ..|.::|:..|.:||.|
  Fly   377 ETFEQVMRFTYSVFTLL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 29/139 (21%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.