DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and AT5G51370

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001032056.1 Gene:AT5G51370 / 835211 AraportID:AT5G51370 Length:446 Species:Arabidopsis thaliana


Alignment Length:503 Identity:109/503 - (21%)
Similarity:188/503 - (37%) Gaps:112/503 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KHLQVRHAPVFRNLDGKLP--NLKVLTIATTMSMDDQHLAAMDDLDMKQFSHLVGFECDGVSLDA 231
            ||:|       .::..:.|  ::|...|.:|:|:.|..|       :|....|...:.:.|||  
plant     6 KHVQ-------NHIKNEKPFNSIKPSEIDSTLSLSDSLL-------LKIIEKLPESQSNDVSL-- 54

  Fly   232 VLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSC-----SPGI-- 289
            |.|..:.||.:|..:   |:.|.|:|      .|.:.|......|..|:|..:|     :.||  
plant    55 VCKRWLNLQGQRLRS---LKLLDFDF------LLSERLTTRFPNLTHVDLVNACMNPRVNSGILF 110

  Fly   290 -----------DTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVP-ESAPIRQLDL-----T 337
                       |:..|....||:           .|..:::..||.:. ||..:..|.:     .
plant   111 CHKSISFHLSSDSSNWEFLEENL-----------LHSDVIDRGLRILSRESFDLLNLKVINASEL 164

  Fly   338 GMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQ 402
            |:|||..:.         |.|:.|:|..|   |.|.:..:            |.|:.|.|..|:.
plant   165 GLLSLAGDC---------SDLQELELHKC---NDNLLHGI------------AACKNLKGLRLVG 205

  Fly   403 GLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTD-RTMATICQYQTRLR 466
            .:.|..:.|:.::.|   .||.:.  |:      :|.:|.|..|..:... :.:...|:.   |.
plant   206 SVDGLYSSSVSDIGL---TFLAQG--CR------SLVKLELSGCEGSFDGIKAIGQCCEV---LE 256

  Fly   467 NLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGL--KLPELRALSLGY 529
            .|:|  |....|.|.:.      .:|....||.|.:..||.:..|.....|  ..|.:.:|.|..
plant   257 ELSI--CDHRMDDGWIA------ALSYFESLKILRISSCRKIDASPGPEKLLRSCPAMESLQLKR 313

  Fly   530 CNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHIL 594
            |.....||.:||.:.|.....:.:..|..:.|: ..::....:|:|.|:|..|:.||...:..::
plant   314 CCLNDKEGIKALFKVCDGATEVNIQDCWGLSDD-CFSLAKAFRRVRFLSLEGCSVLTSGGLESVI 377

  Fly   595 AHGHNLVQLIACSIDGMDHEQAQRILESQRPQMKQVLLXQERYIHXRS 642
            .|...|..:...|...:...:....|.|....:|::.. .:...| .|
plant   378 LHWEELESMRVVSCKSIKDSEISPALSSLFSLLKELTWRPDTRSHLSS 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 8/39 (21%)
LRR_RI <297..482 CDD:238064 41/191 (21%)
leucine-rich repeat 304..330 CDD:275381 5/26 (19%)
leucine-rich repeat 331..357 CDD:275381 5/30 (17%)
leucine-rich repeat 358..379 CDD:275381 6/20 (30%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 37/167 (22%)
leucine-rich repeat 438..464 CDD:275381 5/26 (19%)
leucine-rich repeat 465..496 CDD:275381 7/30 (23%)
leucine-rich repeat 497..521 CDD:275381 7/25 (28%)
leucine-rich repeat 522..547 CDD:275381 8/24 (33%)
leucine-rich repeat 548..573 CDD:275381 2/24 (8%)
leucine-rich repeat 574..599 CDD:275381 7/24 (29%)
AT5G51370NP_001032056.1 AMN1 115..290 CDD:187754 49/231 (21%)
leucine-rich repeat 149..175 CDD:275381 7/34 (21%)
leucine-rich repeat 176..197 CDD:275381 8/35 (23%)
leucine-rich repeat 198..229 CDD:275381 9/41 (22%)
leucine-rich repeat 230..254 CDD:275381 5/23 (22%)
leucine-rich repeat 255..278 CDD:275381 7/30 (23%)
AMN1 <273..405 CDD:187754 30/132 (23%)
leucine-rich repeat 279..305 CDD:275381 7/25 (28%)
leucine-rich repeat 306..331 CDD:275381 8/24 (33%)
leucine-rich repeat 357..382 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.